Advertisement

Ktirf.dating.az is the 3364339:th largest website within the world. The website is created in unavailable, owned by unavailable person, currently located in Ukraine and is running on IP 213.155.4.99 registered by not detected network. This site not uses Javascript for user interaction. This site uses CSS to manage the site layout. This site is running on the nginx webserver. The server side programming lanquage of the site is PHP/5.2.14 . Ktirf.dating.az Google Pagerank is 0 and it's domain is Country Domain. Ktirf.dating.az estimated worth is $931.59, with 233 estimated visites per day and ad revenue of $ 0.70.

Title: Dating website

Description: Dating website - great way to find new friends or partners, for fun, dating and long term relationships

Keywords: Dating Matchmaker Women Love Wedding Men Personals Speed Dating Looking For Women Looking For Men

Created: unavailable

Expires: unavailable

Owner: unavailable

Hosted in: Ukraine

Host IP: 213.155.4.99

ICANN Registrar: unavailable

Domain Suffix: az

Domain Archive: ktirf.dating.az in the past

Alexa Rank: #4304191

Google Page Rank: 0

HOSTCLASSTYPETTLDATA
dating.az IN A 7200 ip: 213.155.4.99
dating.az IN NS 7200 target: ns15.zoneedit.com
dating.az IN NS 7200 target: ns18.zoneedit.com
ktirf.dating.az IN CNAME 7200 target: dating.az
dating.az IN SOA 7200 mname: dns0.zoneedit.com
rname: zone.zoneedit.com
serial: 1483806660
refresh: 2400
retry: 360
expire: 1209600
minimum-ttl: 300
dating.az IN MX 7200 pri: 10
target: ALT2.ASPMX.L.GOOGLE.COM
dating.az IN MX 7200 pri: 20
target: ASPMX2.GOOGLEMAIL.COM
dating.az IN MX 7200 pri: 20
target: ASPMX4.GOOGLEMAIL.COM
dating.az IN MX 7200 pri: 20
target: ASPMX3.GOOGLEMAIL.COM
dating.az IN MX 7200 pri: 10
target: ALT1.ASPMX.L.GOOGLE.COM
dating.az IN MX 7200 pri: 20
target: ASPMX5.GOOGLEMAIL.COM
dating.az IN MX 7200 pri: 0
target: ASPMX.L.GOOGLE.COM

Server Name: 99-4-155-213.hosting.ua

Server Type: nginx

Server Side Language: PHP/5.2.14

Javascript Usage: no

CSS Usage: yes

RSS Usage: no

Google AdSense Usage: no

Additional technologies usage: jQuery | GoogleFontApi

ktirf.dating.az - Daily Traffic Rank Trend In The Past 4 Months

Keyword Count Density
Dating 6 4.11
Women 3 2.05
Baku 2 1.37
Moscow 2 1.37
Unspecifiedmalefemale 2 1.37
Areathe 2 1.37
Popular 2 1.37
Usa 2 1.37
Kubanismall 1 0.68
Avivtemirtauternopolthailandthe 1 0.68
Regionthe 1 0.68
Rostov 1 0.68
Donurotterdamrovnorubtsovskrudniiryazanrybinsksakhalinsalekhardsalonikisamarasamarkandsan 1 0.68
Diegosan 1 0.68
Franciscosaransksaratovsarganssarovsayanskseattlesemipalatinskseoulserbiasergiev 1 0.68
Kaluga 1 0.68
Areasverdlovsksvetlogorsksvobodniiswedenswitzerlandsydneysyktyvkarsyzrantaganrogtagiltallinntambovtaraztartutashkenttatarstantbilisitchaikovskyteherantel 1 0.68
Visherasmolensksmorgonsnezhinsksochisofiasolikamsksolnechnogorsksosnovii 1 0.68
Oskolstavropolsterlitamakstockholmstrasbourgstrezhevojstuttgartsukhumisumgaitsumysurgutsverdl 1 0.68
Posadserovserpukhovsevastopolseverobajkalskseverodvinskseverskshadrinskshchelkovoshekishymkentsimbirsksimferopolsingaporeslavutichslavyanskslavyansk 1 0.68
Africaspainspasskstary 1 0.68

We are absolutely certain that every one is able to earn money from his website, Therefor we will display a short estimated numbers that might be achievable through dedication and seriousness work on your website.

Our estimations point that your Website Value is $931.59, Your Daily Visitors could be in the area of 233 per day and your potential Daily Revenues could be around $0.70.

Server Country Code: UA

Server Country Name: Ukraine

Server Latitude: 50.450000762939

Server Longitude: 30.523300170898

From - to Netname Country Admin Tech Status
213.155.4.96 - 213.155.4.103 eminst UA DUMY-RIPE DUMY-RIPE ASSIGNED PA
213.155.0.0 - 213.155.31.255 UA-HOSTING-20080402 UA DUMY-RIPE DUMY-RIPE ALLOCATED PA
212.0.0.0 - 213.255.255.255 EU-ZZ-212-213 EU DUMY-RIPE DUMY-RIPE ALLOCATED UNSPEC
0.0.0.0 - 255.255.255.255 IANA-BLK EU # Country field is actually a DUMY-RIPE DUMY-RIPE ALLOCATED UNSPEC
Address 213.155.4.99 11010101.10011011.00000100.01100011
Netmask 255.255.255.0 = 24 11111111.11111111.11111111.00000000
Wildcard 0.0.0.255 00000000.00000000.00000000.11111111
Network 213.155.4.0/24 11010101.10011011.00000100.00000000
HostMin 213.155.4.1 11010101.10011011.00000100.00000001
HostMax 213.155.4.254 11010101.10011011.00000100.11111110
Broadcast 213.155.4.255 11010101.10011011.00000100.11111111
Hosts/Net 254 Class C

knirf.dating, kxirf.dating, ktarf.dating, ktkrf.dating, ktigf.dating, ktikf.dating, ktilf.dating, ktimf.dating, ktirj.dating, ktirfkdating, ktirf.kating, ktirf.nating, ktirf.dkting, ktirf.dmting, ktirf.dvting, ktirf.dzting, ktirf.daging, ktirf.dawing, ktirf.dazing, ktirf.datino, ktirf.datins, ktirf.datinx, ktirf.datnig, pktirf.dating, rktirf.dating, kctirf.dating, kztirf.dating, ktbirf.dating, ktfirf.dating, ktqirf.dating, ktuirf.dating, ktxirf.dating, ktifrf.dating, ktiprf.dating, ktitrf.dating, ktirfm.dating, ktirf.qdating, ktirf.dafting, ktirf.dakting, ktirf.daoting, ktirf.dasting, ktirf.datfing, ktirf.datping, ktirf.datring, ktirf.datirng, ktirf.datizng, ktirf.datinjg, ktirf.datinrg, ktirf.datingb, ktirf.datingf,

לאןרכץגשאןמע, лешкаювфештп, نفهقبويشفهال, ншсиолаьшсхж, jtird;s*tibf, ktirf.dating, κτιρφδατι,γ, לאןרכץגשאןמעץשז, лешкаювфештпюфя, نفهقبويشفهالوشئ, ншсиолаьшсхжлью, jtird;s*tibf;*ù, ktirf.dating.ay, κτιρφδατι,γαψ

dating.az domain is not supported